Send

Food Packaging Bag

Gift Box & Bag

Industrial Packaging Bag

Logistics Packaging

Machinery for Packaging Supplies

Non Woven Bag

Other Bags & Cases

Package & Conveyance

Package & Printing Service

Packaging Bags

Packaging Materials

Packing Bottle

Packing Machinery

Post-Press Equipment

Pre-Press Equipment

Printing Machinery

Printing Materials

Shopping Bags

Specialized Case & Box

Stencil

Tag & Sign

Tag Gun

Tool Packaging

Watch Box

IPDBChina IndustryChemicals



China, Chinese SBR/NBR/EPDM Rubberabrasion/Oil/Heat/Wear Resistant, Pattern Belts Is Available. General-Purpose Belt, Fire-Resistant, Conveyor Belt1 Industrial Products Supplier Manufacturer Details, price list catalog:

China Industrial Products Supplier Manufacturer List Catalog
« Previous Next »

Rubber Rubber ProductsRubber BeltPattern Belts Is Available. General-Purpose BeltFire-ResistantConveyor BeltRubber Conveyor BeltConveyor Belt

Weifang Zhenxing Rubber Co., Ltd.

Preview:

Product Description  Product DescriptionMultiply Fabric Conveyor BeltsMultiply fabric conveyor belt made of nylon fabric,SBR/NBR/EPDM rubber,high tensile strength, abrasion/oil/heat/wear resistant, pattern belts is available. General-purpose belt, Fire-resistant , Cold-resistant Wear-resistant type, Heat-resistant type, Acid and alkaline resistant type, Oil-resistant type, Antistatic electricity type, High-grade type and etc.Specifications:This is a polyester conveyor belt rubber that is made from structured weft and warp. We are nylon fabric conveyor belt manufacturer. This fabric conveyor belts is known for its high strength, resistance to wear and fatigue resistance. The fabric belt conveyor is used through various conditions for long-distance transportation and it is used in most industries including construction, ports, among others.Applications: Our multiply fabric conveyor belts are suitable for shifting loose, relative big density type big, middle, and small mineral locks, coal materials etc. Rubber conveyor belting has a relatively big impact on force and abrasion. Not Suitable for hot and oily materials conveyor .Especially suitable for working in severe environment, which requires relatively high belt dimension stability.  Specification and technical data of conveyor belt rubberFabric typeFabric structureFabric specsPly thicknessStrength(N/mm)Cover thicknesswidthlengthwarpweftmm/ply2ply3ply4ply5plyupperlowermmmpolyesterpolesterpolyamineEP800.951602403204001.5-120-4.5400-250050-500EP1001200300400500EP1501.1300450600750EP2001.24006008001000500-2500EP2501.35500750010001250EP3001.4560090012001500EP3501.6-105014001750800-2500EP4001.75--160020001000-2500EP5001.9--20002500EP6302.1--24003000Adhesion and elongation of rubber conveyor beltingBelt carcassAdhesive strengthElongationBetween plies(N/mm)Between rubber and carcassLongitudinal elongation at break%≥Longitudinal elongation at reference load%≤EP canvas≥5≥5102Cover rubber GradeCover gradeTensile strengthElongationAbrasionTensile strength and elongation after agingStandard≥≥≤ MPa%mm3% M24450125-50Austrilia Standard AS1332-2000CN17400200-50 RMA117400175-50USA StandardRMA214350250-50 Z15350250-50Germany Standard DIN22102Y20400150-50 X25400120-50 W1840090-50 C10150200-50Russia standard ГОСТ20-8N15400100-50 T214.7300200-50 M14.7350150-50       Company Profile   FAQ(1)Q: Are you a factory or trading company?A: We are a factory with an export license. We have the most convenient transportation conditions.(2)Q: Do you offer samples?A: We are glad to offer you free samples. New clients are expected to pay for the delivery cost, this charge will be deducted from the payment for the order.(3)Q: How about the lead time?A: Within10-20 days after getting the prepayment or L/C.(4)Q: How can we pay?A: For a small sample shipping costs, you can pay either by PayPal or by T/T. And by T/T or L/C at sight for a large amount of the order.(5)Q: Can you do CO, Form E, Form F, Form A, etc? A: Yes, we can do them for you.(6)Q: What is your factory's main product?No.Rubber Conveyor Belt1Conveyor Belt for General Purpose1.1EP(polyester) Conveyor Belt:EP100,EP125,EP150,EP200,EP250,EP300,EP400,EP500,EP6301.2NN(Nylon) Conveyor Belt :NN100,NN125,NN150,NN200,NN250,NN300,NN400,NN500,NN6301.3Cotton Conveyor Belt:CC-56 CC701.4Steel Cord Conveyor Belt:ST630,ST800,ST1000,ST1250,ST1600,ST2000,ST2500,ST3150,ST4000,ST4500,ST5000,ST54002Conveyor Belt for Special Purpose2.1Heat Resistant Conveyor Belt2.2High-Temperature Conveyor Belt2.3Fire Retardant Conveyor Belt2.4Cold Resistant Conveyor Belt2.5Oil Resistant Conveyor Belt2.6Chemical Resistant Conveyor Belt3Chevron (PaConveyor Belt4Bucket Elevator Conveyor Belt5Sidewall Conveyor Belt  6Flat Transmission BeltWelcome Contact us soon for any inquiry about the Rubber Conveyor Belt~ you may also like 

Link supplier or manufacturer »

Chemicals: SBR/NBR/EPDM Rubberabrasion/Oil/Heat/Wear Resistant, Pattern Belts Is Available. General-Purpose Belt, Fire-Resistant, Conveyor Belt
Hot Sale Black Coconut Shell Activated Carbon for Food Grade Additives6457byte
Best Price Coconut Shell Activated Carbon Granule for Gas Purification6457byte
Water Chemical Treatment 12*40 Mesh Coconut Shell Activated Carbon6457byte
High Quality Coconut Shell Activated Carbon for Drinking Machine6457byte
High Quality Iodine Value 1000 Mg/G Coconut Shell Activated Carbon for Laboratory6457byte

Water Purification Use Coconut Shell/Wood Based Activated Carbon Granule6457byte
Good Quality Granular Coconut Shell Activated Carbon Granule for Gas Purification6457byte
High Quality Low Ash Content 5% Coconut Shell Activated Carbon for Sale6457byte
Facory Price Gold Extraction Activated Carbon with High Qualiry5964byte
Factory Supply High Strength Coconut Shell Activated Carbon Granule6457byte

Factory Supply High Grade Filter Media Anthracite Coal Sand for Water Treatment2255byte
Activated Carbon for Ocu of Waste Water Treatment Plant3065byte
Gold Recovery Bulk Food Grade Activated Charcoal Powder3046byte
500cc Oxygene Absorbers Food Storage Oxygene Absorber5973byte
High Methylene Blue Count Coconut Shell Activated Carbon Granule for Sale6457byte

Waterproof Honeycomb Activated Carbon for Exhaust Gas Treatment1725byte
Swimming Pool / Food Decolorization Bulk Wood / Coal Based Powdered Activated Carbon Wastewater Treament for Oil Adsorption / Heavy Metal Removal2366byte
Black Granular Coconut Shell Coal Based Granular Powdered Activated Carbon Treatment for Wastewater / Air Purification / Water Treatment2913byte
Iodine Value 1000 Water Treatment Chemicals Coal Crushed GAC 8X30mesh Bulk Activated Charcoal Carbon Granules for Sale for Chlorine Removal / in Aquarium Filter1875byte
Impregnated Sulfur KOH Naoh Potash Copper Oxide Formaldehyde Pellets Columnar Cylinder Activated Carbon2238byte

High Quality Silver Impregnated 12X40mesh 8X30mesh Anthracite Bituminous Coal Coconut Granular Activated Carbon Filter Media for Industrial Water Purification1875byte
Coal Based Activated Carbon Granular 8*30 Mesh for Drinking Water Filtration2323byte
2mm/3mm/4mm CO2 Adsorption Water Purification Air Filtration Uses Coconut Coal Bulk Pellet Activated Carbon Column Activated Charcoal for Mask2359byte
High Quality Powdered Activated Carbon for Waste Water Treatment Sewage Disposal2651byte
Chopped Carbon Fiber for Conducting Floor1220byte

Factory Direct Sale Best Catalytic Bituminous Coal Based Cylindrical Pellet H2s Removal Activated Carbon with Permanganate Potassium for Air Purification1635byte
Pelletized Coal Based Activated Carbon for Water Treatment Columnar Filter Media4011byte
Extruded Pellet Activated Carbon Low Ash Columnar Activated Carbon for Catalyst Carrier2426byte
T700 Carbon Fiber for Sports Leisure854byte
Coal Based Granular Activated Carbon for Air Purification/Water Treatment GAC4115byte

4mm Coconut Coal Based Special Columnar Extruded Pellet Column / Granular Activated Carbon Made by Coal Impregnated with KOH, Ki, Naoh, Copper, ASTM Standard1712byte
Honeycomb Activated Carbon for Water Treatment Filter Media4011byte
Industrial-Grade Activated Carbon for Air and Gas Purification2465byte
Columnar Coal Based Activated Carbon for Gas / Air Filtration Cac4367byte
Air Filter China Bulk Price Adsorption Black Coal Based Granular Pellets Cylinder Column Pelletized Activated Carbon for Gas / Air Filtration / Solvent Recovery1590byte

Carbon Fiber for Tripod, Bike, Boat1179byte
Granular Activated Carbon for Air Purification & Gas Mask4103byte
Anthracite/Bituminous Coal/Wood/Coconut Shell/Bulk Granular/Pellet/Powdered/Powder/Impregnated/Honeycomb/Extruded Active/Activated Carbon Price Water Treatmen1974byte
High-Quality Low Ash Coal-Based Activated Carbon for Pure Air and Water5078byte
Premium Quality Coal Based Columnar Activated Carbon for Water Treatment4367byte

Factory Price Ammonia Adsorption Column Activated Carbon for Mercury Remove2495byte
Water Filter Ctc55 Acid Washed Mesoporous 12X40mesh 1100mg/G Coconut Coal Based Granular Activated Carbon for Drinking Water Treatment / Water Treatment Price1635byte
T700, 800, 1000-12K 24K Filament Yarn Carbon Fiber in China756byte
Premium Reactivatable Pelletized Carbon for Effective Filtration Solutions3959byte
Water-Resistant Voc Waste Gas Adsorption Honeycomb Activated Carbon Catalytic Carbon1725byte

25kg Bag Good Adsorption GAC830 1050 Iodine Coal Based Coconut Shell Base Granular Silver Activated Carbon Supplier in Drinking Water / Aquarium / Fish Tank1869byte
Coconut Shell Granular Activated Carbon for Advanced Water Treatment GAC4389byte
Granular, Powder, Pellet Type Coal/Coconut/Wood Based Activated Carbon Manufacturer for Gas Purification / Water Treatment / Gold Recovery / Decolorization2934byte
6-12 Mesh Activated Carbon Gold Recovery Coconut Shell Based Steam Activated Carbon4442byte
Factory Sale Gold Recovery Columnar Water Filter Granular Powder Coconut Shell Activated Carbon3554byte

Gold Mining / Water Treatment / Air Purification Granular Coal Palm Kernel Shell Nut Shell Coconut Shell Based Active Charcoal Carbon Manufacturer1913byte
Industrial Grade Powdered for Wastewater Treatment Activated Carbon4022byte
Coconut Shell Activated Carbon with High Adsorption Capacity3075byte
12-40 Mesh Coconut Shell Activated Carbon for Drinking Water Treatment1640byte
Coconut Shell Based Gold Mining Silver Coated Activated Carbon Charcoal4381byte

Coconut Shell Activated Carbon for Gold Processing Recovery Refining Activated Carbon4442byte
6X12 Mesh Coconut Shell Charcoal Gold Adsorption Granule Activated Carbon2445byte
Organic Coconut Charcoal Activated for Eco-Friendly Filtration Solutions3078byte
Bulk Coal Coconut Shell Based Granular Activated Carbon Charcoal Manufacturers Price Per Ton for Gold Mining and Gold Recovery for Sale1875byte
Jacobi Coconut Shell Based Activated Carbon Goldsorb Gold Sorb 5500 6000 for Gold Industry Usage Mining in Sudan Market6457byte

Coconut Active Carbon Raw Material Extract Gold 6X12 Activaed Carbon on Sale2049byte
Coconut Shell Activated Carbon for Gold Recovery and Gold Extraction Processing4442byte
Supercapacitor Activated Carbon1678byte
Gcn-612g Coconut Shell Activated Carbon for Gold Recovery3471byte
Coconut Shell Charcoal Coconut Charcoal Good Price From China2445byte

Best Selling Coconut Activated Carbon for Drinking Water Purification3769byte
Factory Direct Industrial Grade Iodine 1000 Activated Coal for Gold Extract2620byte
Coconut Based Activated Carbon Granular Pellet Powder Activated Carbon Wholesale Price4554byte
Gold Recovery 6X12 Mesh Coconut Shell Activated Carbon1987byte
High Iodine Coconut Shell Activated Carbon Coconut Shell Activated Charcoal for Gold Treatment6457byte

Granular Coconut Shell Activated Carbon for Gold Recovery GAC4442byte
High Iodine Granular Coconut Shell Activated Carbon for Water Purification Gold Extraction4119byte
Coconut Shell Charcoal Gold Purification Vegetable Activated Carbon Coconut Shell Activated Carbon2006byte
Premium Antibacterial Cosmetic Grade Activated Carbon Powder for Skin Care3231byte
Ultra-Pure Natural Activated Carbon Powder for Beauty Treatments3353byte

Activated Bio Balls Adhesion and Breeding Nitrifying Bacteria and Anaerobic1014byte
Coal-Based Honeycomb Activated Carbon for Air Purification Water-Resistant2858byte
Premium Coal-Based Granular Activated Carbon for Purified Water2368byte
Petroleum Additive Coconut Shell Granular Activated Carbon5646byte
Granular Activated Carbon1940byte

Factory Direct Sales Cylindrical Activated Carbon Coal Based Columnar Activated Carbon in Water Treatment4083byte
Coal Based Granular 8*30 Mesh Water Treatment Activated Carbon3096byte
Rt Filter Activated Carbon Coconut Small Through Hole Resistance4881byte
Factory Supply Coal Based Granular Activated Carbon Filter Material5150byte
6X12 Mesh Coal Activated Carbon for Gold Recovery and Gold Extraction Processing3285byte






Purchasing Request


Note: Send your purchase request, and we will screen suppliers or manufacturers for you free of charge...

  • Professiona Secured Trading Service
  • Verified Business Licenses to Supplier or Manufacturer
  • Welcome to our Global alliance Member